Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_9032_iso_3
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family TALE
Protein Properties Length: 350aa    MW: 39820.2 Da    PI: 4.9405
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                                          HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                             Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                                          k +yp+++++  LA+++gL+++q+ +WF N+R ++
  cra_locus_9032_iso_3_len_1508_ver_3 293 KWPYPTEADKISLAESTGLDQKQINNWFINQRKRH 327
                                          679*****************************885 PP

                                  ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                                          ELK++LlrKY+ +++sLk EFs
  cra_locus_9032_iso_3_len_1508_ver_3 247 ELKERLLRKYGNHISSLKLEFS 268
                                          9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5121310.458247267IPR005539ELK domain
SMARTSM011885.8E-6247268IPR005539ELK domain
PfamPF037892.4E-7247268IPR005539ELK domain
PROSITE profilePS5007112.811267330IPR001356Homeobox domain
SMARTSM003891.8E-13269334IPR001356Homeobox domain
CDDcd000862.90E-13279331No hitNo description
PfamPF059201.0E-17287326IPR008422Homeobox KN domain
PROSITE patternPS000270305328IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002263313.11e-138PREDICTED: homeobox protein knotted-1-like 6
SwissprotQ84JS61e-125KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLD7TDJ71e-138D7TDJ7_VITVI; Putative uncharacterized protein
STRINGVIT_01s0127g00210.t011e-138(Vitis vinifera)